Sale!

wetakeprideintreatingeachandeverycustomerweserveasiftheywerefamilyweenjoyhelpingpeoplediscoverthealkalizecpowderphysicaenergetics0.webp

Alkalize-C Powder Physica Energetics

Name: We take pride in treating each and every customer we serve as if they were family. We enjoy helping people discover the Alkalize-C Powder Physica Energetics
SKU: mode_7513966772460
Price: 21.00 USD
Availability: InStock

Original price was: $ 35,00.Current price is: $ 21,00.

Size

Clear

SKU: mode_7513966772460 Category: Uncategorized Tags: Physica Energetics, Powders

Description
Ingredients
Warnings

Non “bowel tolerance” buffered Vitamin C powder antioxidant defense supporting immune and cellular health.

Supplement Facts

Serving Size: 1 heaping teaspoon (6 grams)

Ingredient	Amount
Vitamin C (ascorbic acid)	4,000 mg
Calcium (ascorbate)	150 mg
Magnesium (ascorbate)	215 mg
Zinc (amino acid chelate)	15 mg
Selenium (amino acid chelate)	50 mcg
Manganese (amino acid chelate)	5 mg
Chromium (GTF-polynicotinate)	50 mcg
Molybdenum (amino acid chelate)	100 mcg
Potassium (ascorbate)	100 mcg
Vanadium (amino acid chelate)	100 mcg
Citrus bioflavonoid (10%)	50 mg

Other Ingredients: Natural orange flavor, natural stevia leaf extract.

- If you are pregnant, nursing, or trying to conceive, taking any medications, or have a medical condition, please consult your healthcare provider before taking any supplements.
- This product is contraindicated in an individual with a history of hypersensitivity to any of its ingredients.
- Keep out of the reach of children.
- Do not use if tamper evident or if safety seal is broken or missing.
- This product is not intended to diagnose, treat, cure, or prevent any disease. For nutritional use only.
Disclaimer: These statements have not been evaluated by the Food and Drug Administration (FDA). These products are not meant to diagnose treat or cure any disease or medical condition. Please consult your doctor before starting any exercise or nutritional supplement program or before using these or any product during pregnancy or if you have a serious medical condition.

Size	180 gm

Fast Shipping with Professional Packaging

Our long-standing relationship with UPS FedEx DHL and other global carriers lets us offer a range of shipping services. Our warehouse staff will package all goods to our exacting requirements. Your goods will go through an exhaustive inspection and adequately secured before being shipped. We deliver to thousands of clients every day from all over the world. This shows our commitment to becoming the largest online retailer on the planet. The warehouses and centers of distribution are situated in Europe, as well as the USA.

Note: Orders containing more than one item will be assigned a separate processing period for each item.

Before shipping, our team will perform an extensive inspection of the products you ordered. Most orders are shipped within 48 hours. The delivery time should be between 3 and 7 working days.

Returns

The stock is constantly changing. It is not managed entirely by us since we are involved with multiple entities, including the factory and our storage. Stocks are subject to change at any time. Please be aware that it's possible that your order could become unavailable even after you've placed your order.

Our policy is for 30 days. If it's been longer than 30 days since you've bought the item We're sorry to say that we can't offer you a complete refund or exchange.

Your item should be in its original packaging and be unused. The item must be returned in its original packaging.

Alkalize-C Powder Physica Energetics

Supplement Facts

Related products

Login